PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN09750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 274aa    MW: 30662.5 Da    PI: 5.0753
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN09750.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
       KHN09750.1 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.45.7e-1770111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       T+ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
       KHN09750.1  70 LTEAEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      699****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-21563IPR009057Homeodomain-like
PROSITE profilePS5129413.76961IPR017930Myb domain
SuperFamilySSF466892.73E-2711108IPR009057Homeodomain-like
SMARTSM007175.1E-131363IPR001005SANT/Myb domain
PfamPF002497.0E-151461IPR001005SANT/Myb domain
CDDcd001678.64E-91661No hitNo description
PROSITE profilePS5129427.76462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2564116IPR009057Homeodomain-like
SMARTSM007172.7E-1566114IPR001005SANT/Myb domain
PfamPF002493.0E-1569111IPR001005SANT/Myb domain
CDDcd001672.79E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLKRCG KSCRLRWTNY  60
LRPDLKRGLL TEAEEQLVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLLKIG  120
IDPVTHEPLK KQAAASSQDS SSSPAEHLPQ PGNNLDDQVK ETEGILLNSE ENSSSSQAEN  180
SSGDDSLLLD SICSDDSLLN SMWLDETPLV EALWDTTPNL ENTSNNMGLL PSWEDNCAWL  240
LDCQDFGIHD FGFTCFNEIE SHALQTIGMK EEGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0988500.0BT098850.1 Soybean clone JCVI-FLGm-16B22 unknown mRNA.
GenBankKC7514530.0KC751453.1 Glycine max cultivar Jilin 32 transcription factor MYBJ1 (MYBJ1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014624866.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-109ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0B2PKX00.0A0A0B2PKX0_GLYSO; Protein ODORANT1
TrEMBLK7MLH00.0K7MLH0_SOYBN; Uncharacterized protein
STRINGGLYMA17G14291.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.15e-89myb domain protein 42
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]